PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.Z3DCJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 167aa    MW: 19729.3 Da    PI: 4.617
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.Z3DCJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.6e-191968857
                 -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                  +eq++ Le  F +++++  e++ +LA +lgL+ rqV vWFqNrRa++k+
  Aradu.Z3DCJ 19 AAEQVNLLEMNFGNEHKLESERKDKLALELGLDPRQVAVWFQNRRARWKN 68
                 679*********************************************95 PP

2HD-ZIP_I/II110.21.4e-3520105893
  HD-ZIP_I/II   8 keqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +eqv+lLE++F +e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y+ Lkra+++   +++rLe+ev +L+e+l++
  Aradu.Z3DCJ  20 AEQVNLLEMNFGNEHKLESERKDKLALELGLDPRQVAVWFQNRRARWKNKKLEEEYSNLKRAHETTLLDKCRLETEVLKLNEQLSN 105
                  79********************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.7E-131073IPR001356Homeobox domain
PfamPF000464.9E-161968IPR001356Homeobox domain
SuperFamilySSF466891.63E-162077IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-202076IPR009057Homeodomain-like
CDDcd000861.13E-132170No hitNo description
PROSITE profilePS5007115.2562169IPR001356Homeobox domain
PRINTSPR000311.5E-54049IPR000047Helix-turn-helix motif
PROSITE patternPS0002704467IPR017970Homeobox, conserved site
PRINTSPR000311.5E-54965IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MNQRSMDEQM MLISQLYPAA EQVNLLEMNF GNEHKLESER KDKLALELGL DPRQVAVWFQ  60
NRRARWKNKK LEEEYSNLKR AHETTLLDKC RLETEVLKLN EQLSNAKEEI QRLQDMVPSN  120
SSSSQSQSQS QSMEIMDPPF LGDYVFCVPE THYINGMEWV DPYENIW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964054.11e-114PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232081e-53ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A151TI403e-68A0A151TI40_CAJCA; Homeobox-leucine zipper protein ATHB-40 (Fragment)
STRINGGLYMA01G38390.13e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47893257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.16e-53homeobox protein 40